DPCstruct | MC21673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 90 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08601 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179GGG6 | 154-231 | PYCRRTAPIPADRLLQPGSTWDFIVSHDLFQRRLVDVCRVAELLVSCARRDGQYSGFSVAEIVNAIEHSIAGGSCYCR |
| G2WY80 | 25-96 | IAEDGERLLAAGATWDLIINHELFKRGLVDVGDVSERLKNHAKCDGQGPVFAERTILTAIEASVASGSDELL |
| A0A7C8KXZ9 | 215-286 | None |
| A0A179EYF1 | 202-311 | None |
| A0A094EVH8 | 50-126 | None |
| A0A0F8A1P4 | 565-660 | None |
| A0A4U0VIC3 | 88-185 | None |
| A0A0S6XS18 | 88-166 | None |
| A0A1X2HQM0 | 123-234 | None |
| A0A5N7CJZ2 | 9-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.