DPCstruct | MC21664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N8R0F6 | 28-108 | YLDGDISRIIEMAWEDRTPFEAISREYGLNESAVIRLMRLHLQTNSFKLWRKRVSGRKTKHLQLRSPEVSRGYCSRQYKHH |
| A0A4Z0LLN1 | 4-61 | NLSDPATLGEIIEMALSDDTSFDQIRALHGFGPDEVKALMRKNLKSGSYRAWRRRVRA |
| X0Q7U3 | 67-143 | None |
| A0A2E3UVM9 | 55-119 | None |
| G5ZVQ0 | 17-96 | None |
| A0A2G4J584 | 1-71 | None |
| A0A5C2HDA4 | 9-86 | None |
| A0A2D9YXB1 | 2-72 | None |
| A0A2E6MAI7 | 4-80 | None |
| Y0KES1 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.