DPCstruct | MC21660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 63.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05915 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8P1W6 | 1-125 | FVFLFHLYRGYNKYAEDTTSRDSDSLIQEYGNISTDEVSTYCWRHPKVRENWRTVLAAVTLLIVGTGLFVMGTFAVADPANTSQGVV… |
| A0A7R9D778 | 263-368 | RDSDSLIQDGGYYSGMYDPSQSCWRHPKVQENWKMVLAAVVLLLVGIGLLITGIIVECLPLPGIQGFAFFIAGFICFIPGAYHVVYI… |
| A0A0L0BV27 | 71-180 | None |
| A0A5E4Q3V8 | 131-233 | None |
| A0A6J1WGQ8 | 1-86 | None |
| H3A1I5 | 78-199 | None |
| A0A164YPH7 | 97-195 | None |
| A0A210Q6B7 | 82-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.