DPCstruct | MC2166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 229 ± 31 aa |
| Standard deviation of domain lengths | 30.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2MNF9 | 193-412 | NGWRNELPAPIMDVRRMVGAVIAEWGRSVSVEDVDEWTRTHRHPSDWLNAPLWRPVSEPLATGHADRDRAVADRHAQTLARLAAMRR… |
| A0A6V8LBY0 | 7-282 | EAGEPIRVPVLFQLGWFRWLPHAGFDFEELLHRFPGTPREEVLAAQRVWNARRNGADLDQNMEPAALAASLPAAPAWAPPDPPADGD… |
| A0A1U9ZYC1 | 92-295 | None |
| I8QJ20 | 197-449 | None |
| A0A7W7HLG2 | 169-338 | None |
| A0A0M9ZZE3 | 27-258 | None |
| A0A0M8WJB8 | 14-283 | None |
| A0A0K9YT33 | 11-231 | None |
| A0A6F8YS84 | 2-239 | None |
| A0A7W3WHL8 | 8-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.