DPCstruct | MC21655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 84 ± 13 aa |
| Standard deviation of domain lengths | 12.93 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560KHL9 | 1-65 | MSAEVETAVLDHALAHPCHGPLRVAQELAMRNIQVSSGGVRGVWQRHNLLTKHDRLLHLEKSTAE |
| B9BXF9 | 2-81 | DPQVEAAVVELALELPAYGQVRIANEVLKRHALSVSPQGVRSIWLRHDLETMPKRLKALEAKSAQEGLVLTEAQLVALER |
| M6V9T1 | 2-95 | None |
| A0A3P3XR58 | 36-99 | None |
| M6VGT1 | 2-84 | None |
| A0A1I1UA50 | 51-116 | None |
| A0A1F3LVD0 | 85-176 | None |
| M6EBT3 | 1-57 | None |
| A0A0K0VL58 | 15-112 | None |
| A0A2P1QQW7 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.