DPCstruct | MC2165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J7ZIT4 | 1-62 | MRATVGDQLVQHGRVVGQHDKVGEIVEVMGQEGNPPYRVRFEDGHEGLCSPGPDTEIRHRDT |
| A0A6V8L6T9 | 21-82 | MQATVGDRLHVHSNTVGAKDRVGEIVEVRGAEGKPPYLVRFPDGHESLVYPGPDTVIEAGQN |
| A0A7I9VY33 | 32-95 | None |
| A0A852TWU9 | 2-58 | None |
| A0A4R6VHX7 | 1-61 | None |
| A0A1Q8LRD1 | 1-67 | None |
| A0A370H4N5 | 1-69 | None |
| A0A6L7GQ33 | 1-62 | None |
| K6V032 | 168-229 | None |
| A0A2W5ZF44 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.