DPCstruct | MC21648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 266 |
|---|---|
| Mean domain length (aa) | 182 ± 34 aa |
| Standard deviation of domain lengths | 34.09 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.26 |
| Pfam Score | 71.00 |
| Assigned Pfam label(s) | CL0123- CL0578- CL0260- PF20217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6CWG3 | 7-196 | NQQKALKYAREHGPFRPRDVAGIGVHPEDIRRLCRKGLLVRAGRGLYGLADAEPTTNQTLIEACKRVPQGVVCLLSALRFHGIGMQL… |
| A0A7J2VWQ2 | 3-183 | ETIILEKFSSMPVFSLADISQITKSKAYAKFLISSLLKKGKIKKIKRDLYTLHEDAFLVATFIIRPSYISSISALSFYGDISQIPNE… |
| A0A367U760 | 8-184 | None |
| A0A7V9GF52 | 15-197 | None |
| A0A7V9EVI1 | 2-151 | None |
| A0A812P0I7 | 7-216 | None |
| D3LKL3 | 19-222 | None |
| A0A430AWY6 | 23-230 | None |
| A0A2W5KBV5 | 5-153 | None |
| A0A6B1AFN5 | 17-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.