DPCstruct | MC21645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 69 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5Z2N6 | 232-292 | IASLKLRTWHDKSLKHTTEAAFKGYKHGVVELQKADLQIIRVGLSELSFPDQKFVREQLKA |
| A0A6B3LCV1 | 1-80 | MKTPLLIALATASLATASARIWTSTDGRKIDAEFVALEDNKVVLNMKGREYRVPIERLSADDQSFANEQQAIADAPPAAA |
| A0A2S7U4U5 | 8-70 | None |
| A0A350AW96 | 46-145 | None |
| A0A5C5ZVA7 | 308-383 | None |
| A0A2S7U3B7 | 510-573 | None |
| A0A5C6AGM7 | 235-286 | None |
| A0A517Y4S3 | 1-56 | None |
| A0A517YBB8 | 394-462 | None |
| A0A517YE64 | 90-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.