DPCstruct | MC21642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 209 ± 44 aa |
| Standard deviation of domain lengths | 43.68 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.49 |
| Pfam Score | 83.78 |
| Assigned Pfam label(s) | CL0020- CL0126- PF03105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RRI8 | 52-184 | IGFVKAYIEKFAYSTATTEEWKAYLFEYFKDKADVLQAVDWKAWIYSPGMPPVKLQYDTTLADDCSALATRWSQAKDADLASFSADD… |
| A0A1J9R1S5 | 757-969 | ENLIGKAKFDKFIPHYFTKYKELSLDSYEFKSSMLHFFSNDSEAHALLTSLDWDKWFYSPGLPPKPDLDTSLVDVVYDLAEKWRTAP… |
| A0A0V0QJ06 | 595-880 | None |
| A0A7M5WKU3 | 801-1114 | None |
| A0A498KNH9 | 648-854 | None |
| A0A7J6PIY8 | 1019-1237 | None |
| A0A4Y7MJI3 | 148-334 | None |
| A0A662Y927 | 91-319 | None |
| A0A2I4ALN6 | 12-196 | None |
| A0A4Q4YEQ6 | 604-819 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.