DPCstruct | MC2164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 454 ± 57 aa |
| Standard deviation of domain lengths | 57.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511T2U3 | 8-361 | LLPVRLETRFIPPKNGSGWLLRVLVSPDEVSIDRHDPIPADSELDSLELMWNRAKGDLDSEEGKSAWRMFAERVGGARAAWLARSFP… |
| A0A6V8L1R5 | 27-492 | ALRAARDELARLLTQVPPNARAILAVQRRISQLTIQLGAARAAAGATRHAYEAGLDALPASLDPAVPLLLLPVRLETRIRARTDGAA… |
| A0A532ED16 | 4-435 | None |
| A0A5P2C8M0 | 6-410 | None |
| A0A1X6ZGG4 | 55-482 | None |
| A0A537ZU44 | 31-433 | None |
| A0A3D1V619 | 222-678 | None |
| A0A2V5TDF4 | 47-564 | None |
| A0A543PNC1 | 26-506 | None |
| A0A535N180 | 8-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.