DPCstruct | MC21639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 98 ± 17 aa |
| Standard deviation of domain lengths | 16.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9U1P9 | 2-82 | KYMFTNAPVDSILVLPEQFKRAIQNSSLWKWERSRQLSTTGCLAVMFPKDDSQDVSFTFWCGHDDGYFLNDLFKVQCALSS |
| A0A1J9Q848 | 50-151 | QAENGTAPSIPDVANDVHIEIGYRCSAARVSEMPQIGELLFAAVQKSNQWIWERVVGGTARKTTDCLNVLVPENRNQDISITLLVGH… |
| A0A2V1DLB1 | 2-92 | None |
| A0A0L0MYJ0 | 186-291 | None |
| A0A3M2S7Z6 | 94-185 | None |
| A0A059JH16 | 1-121 | None |
| T5BWB9 | 70-153 | None |
| A0A0J6FK29 | 133-251 | None |
| A0A094FS74 | 147-267 | None |
| A0A7J6II05 | 37-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.