DPCstruct | MC21637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5Y357 | 3-95 | VSIHSATLGSSGEVRRGRFLSEMEAIAERKAGRDVVVCGNDLATNRTTAERIETSANGVSKRCPPHVNAGPNALPHFQPKSRPPTGH… |
| R5L139 | 67-165 | AAIRSAISNNKYTKYWEAKRTNGYVVLGRPLTFRDAMQRVKGGSDVFASSHANALTLAYSITSSPIGPEIDQGKLFSDGYYYHYHIN… |
| A0A7X8L7R8 | 242-356 | None |
| A0A810E401 | 99-202 | None |
| A0A318EP62 | 190-293 | None |
| A0A378RL86 | 3-84 | None |
| A0A1R1E0N9 | 165-255 | None |
| W6S0M8 | 114-200 | None |
| E6EYE8 | 92-187 | None |
| A0A6G7F127 | 44-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.