DPCstruct | MC21636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 206 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349YI04 | 168-362 | LKSMYQKDLDEMLADENLSDEQQEVLDSYVRKICLDLSPSTMNRICWAVEKYFANYQEQPFEEFDYSVYKSGVEYDMSRFYLVRDCC… |
| R5KU83 | 57-259 | ALREFQMTVDEMMEIPADRLSERQKDFLRYYNYRMPVGVGDCVMNKICRRFEEEFDGFIKQSVNNQNFDYRIMKSDVEYTPRQYTAI… |
| A0A0S2S300 | 105-334 | None |
| A0A843GJW4 | 7-192 | None |
| A0A843FR74 | 316-528 | None |
| A0A1C2XSZ6 | 851-1048 | None |
| A0A6G4A150 | 105-308 | None |
| A0A658JNN6 | 2-208 | None |
| A0A0H3JAF4 | 454-677 | None |
| A0A7C6K3V6 | 659-850 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.