DPCstruct | MC21635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 21.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6GQM5 | 4-121 | YEEVLGHMSGTSLQSDFFSHPAVPALMRYIVSHQDPSLGTACTSSWVRWPFVLPAPSLAAGLVEKHGLSNRYTESSVIFNCPHHGEH… |
| A0A6C1M4U7 | 96-216 | LPDYTELLAILSNRYGITHRIRLEEEFLKSDGVGGIIREIINDRDGLIRCLAPATGRLAIRAACPECGLVDKYGMNNIYSQGGSTVS… |
| A0A2V3ISK4 | 4-127 | None |
| A0A167AYB2 | 78-198 | None |
| A0A420TLC8 | 1-100 | None |
| A0A5M3YUJ7 | 206-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.