DPCstruct | MC21634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6GGI4 | 1-120 | MYSFKIALFAVLALLAVSTIADVTGRFNIVSKYKYTKTHPDGHKTTEEQRNPVAYENKKLKSDKTLEKFVKDFGTWSNHEFTCTKKA… |
| A0A4Z1JC32 | 37-128 | ATNSVAMRLNYSAKYENGTVATYTSKSAGRIPDSVGYKIIANIQTWSGGKYTVTRREEQNLITVKNVVPAPDKGTGSDQVKEMQSIV… |
| A0A0B4I8D1 | 128-237 | None |
| A0A319ETL7 | 51-128 | None |
| A0A401KYE8 | 16-109 | None |
| A0A319EWE1 | 99-205 | None |
| A0A395J6Y4 | 18-134 | None |
| A0A7H8R9Z5 | 1-114 | None |
| A0A1Y2WS14 | 1-104 | None |
| A0A0L0N5H5 | 95-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.