DPCstruct | MC21633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2PIH0 | 2-101 | FNATRVLGVAYRGISLEALGMEAGVGYSSTVDIAGNNIEKKFPVVVEGRVQGTKPHQSSKDKSDKKDVVTVGYYTAKGTRILTIHAH… |
| A0A5C6G9B4 | 44-139 | KLLRLVGRVTLTDVEKVNGIEGAKWTENVKGVTHNVGSERTDAAAYEIQGAMAHKSHKDANETQNVITLTFYSIQGTRIGSAHVRED… |
| F0UW72 | 7-112 | None |
| A0A319D6I7 | 2-63 | None |
| A0A395H706 | 47-143 | None |
| A0A0C3DAF2 | 53-149 | None |
| A0A319CY50 | 53-168 | None |
| A0A1V6Y9L1 | 7-121 | None |
| A0A177A4L0 | 9-98 | None |
| A0A5N6KX45 | 199-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.