DPCstruct | MC21632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 214 ± 44 aa |
| Standard deviation of domain lengths | 43.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4ZLY9 | 38-199 | MPSPRQLEIRQRKLRSLMSTELLKHYAHLERNLPLELWDIVAHYLIPHFTSANLQSQWEPRPEPSYASLSRGIWCKYVDFEGTRYIS… |
| A0A5C6G6Q4 | 1-238 | MPNFDHCFALRCGLCTFELRAEDRVVACSPDGIQVKNFSYERRCHSCEHPNGIIPTFHEECHKKVGTPFPEQLAVTCCDFDPSPNQS… |
| A0A6A6NLS1 | 63-235 | None |
| U7PT05 | 9-314 | None |
| U7PRM7 | 4-150 | None |
| A0A0F8A3Q7 | 20-177 | None |
| A0A1B8A9M9 | 752-906 | None |
| Q2HDY1 | 1-219 | None |
| A0A3D8T2E6 | 3-241 | None |
| A0A365NHL2 | 303-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.