DPCstruct | MC2163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 149 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19822 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2JD15 | 1-151 | MEIKCYPALYQDPQGTVTTCIENDGKKLSMIVRDVEFTSSMLDDWMPQEKTNTSSLQTFTLHNQELCGFTLTFSMPIAVIFHSEQLE… |
| A0A1S8NBG9 | 1-141 | MVNIKYNALYTDNLGCEKAVVYFSKKGLQLDIRGCSFENEYLDFDFVAKSSNEAKHLFYMKDNELIDYVLDIKIPLILTHSNTEYSE… |
| K0EVP5 | 8-156 | None |
| A0A7X0HH69 | 1-156 | None |
| A0A2V5WXP7 | 2-149 | None |
| A0A1W7LTP5 | 4-165 | None |
| A0A1H6X4E8 | 1-151 | None |
| A0A350K782 | 2-145 | None |
| A0A3D5MRH3 | 1-140 | None |
| M1N3F2 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.