DPCstruct | MC21628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 156 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1MTN9 | 1-153 | MSAIITPYVVNETGVAVFPVDKPTSNYIGAGRRFLISPLPREQVENTPDGVVDLNYSLVANQSLTPFFQSERVFNALGGEDSIVHWV… |
| A0A771MZE7 | 1-168 | MRVLLRPVLVPELGLVVLKPGRESLPVFHRGRVLVEPEPKNMRALPSGAVPTVRQPLAEDKSLLPFFSDERVIRAAGGAGALSDWLL… |
| A0A6D0WA84 | 1-165 | None |
| A0A508ZRV0 | 3-136 | None |
| A0A377AZH2 | 1-133 | None |
| I0QPV8 | 3-170 | None |
| A0A0F3U059 | 1-168 | None |
| A0A1B1KMA6 | 20-160 | None |
| A0A843QAC5 | 1-151 | None |
| A0A766JCB4 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.