DPCstruct | MC21627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 365 ± 114 aa |
| Standard deviation of domain lengths | 113.62 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 75.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P0PZN0 | 1-293 | MSKVFICAAIPDELATREEGAVAVATAIEAGDERRARAKFHWQFLEHYPAAQDCAYKFIVCEDKPGIPRPALDSWDAEYMQENRWDE… |
| A0A854JCZ2 | 1-212 | MSKIFICAAIPDEQAIKDEGAVAVATAIEAGDERRARAKFHWQFLEHYPAAQDCAYKFLVCEDKPGIPRPALDSWDAEYMQENRWDE… |
| A0A6D0U279 | 1-432 | None |
| A0A6D0UC49 | 1-207 | None |
| A0A0F6B083 | 8-432 | None |
| A0A4U9HEA4 | 2-221 | None |
| F4TGA8 | 1-356 | None |
| A0A089RA50 | 3-294 | None |
| A0A2X7GD18 | 7-439 | None |
| A0A726XV74 | 4-617 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.