DPCstruct | MC2162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0I1D0 | 1-119 | MKVFLTGSAAALAMALCAAPTIATAQTSAATTTTTTTVVLTPEQQAAYAAWNATQQAAYNAWASDLQTYYWGLTPEQRTAWWALTDA… |
| A0A5S3P9L5 | 4-146 | TFWYIIGGQLATISIPAMAQEPPPTEAEAPLADETVPAMMTAEQSAIYAGWTAEKRAEHDGWADDIRAYFWTLPAARQDIFWRLTHN… |
| A0A845A041 | 1-110 | None |
| A0A411ZBD0 | 15-124 | None |
| A0A326GD81 | 1-108 | None |
| A0A2N3AWM3 | 5-109 | None |
| A0A259K250 | 1-129 | None |
| A0A6I5WVD7 | 1-145 | None |
| A0A2Z2PGJ3 | 27-131 | None |
| A0A6I4UQ79 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.