DPCstruct | MC21612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 440 ± 44 aa |
| Standard deviation of domain lengths | 44.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.40 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0137- PF14420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1DHE0 | 1-480 | MVYSWDDKEAICYRLYVEERRSLEEVICYWEIRGFTPSKRAFQTQFKRWEFPSKQNPAYKNSALVARVRALWASNYTQKDMVDTLQA… |
| A0A1Y2M957 | 1-480 | MVYHWDDKEAECYRLYVEEKKSLDEVIAYWEARGFTPSKRAFQTQFKRWDFPSKQNPAHKNPAIIARLQQLWEQNHTQKEMVDILQS… |
| A0A6V8QX22 | 1-419 | None |
| A0A0P7B8G1 | 57-457 | None |
| A0A2P7YG96 | 474-849 | None |
| J3NRW7 | 1-536 | None |
| A0A438NAF7 | 453-884 | None |
| A0A2S6BQY0 | 22-482 | None |
| A0A094CGV6 | 1-444 | None |
| A0A1B5KVN4 | 1-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.