DPCstruct | MC21611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 118 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8S0A4 | 1-126 | MHMNKVGTLASLLQFAFQYPSLSLATDDTPEAKLKPCTIYSPNTGAYFDLKTISLLPPEMKDGKKIRPDDRETSWHSRGYDYGANFT… |
| A0A2W1D9A1 | 1-119 | MIALLYSLLLLVASSTFATAASDKPLKPCTVISPTSERFFDLNPMRRLPPSKEDGKKSNKKEAEEGSWHARGYDYNANFTINFCGPV… |
| A0A3M7H8U5 | 102-227 | None |
| A0A1J9RNE5 | 7-120 | None |
| A0A842YYG0 | 1-112 | None |
| A0A3M6W6T1 | 135-264 | None |
| A0A420YJ00 | 24-136 | None |
| A0A7C8N1Y6 | 10-123 | None |
| A0A0F8DAC4 | 6-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.