DPCstruct | MC2161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 7.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9YTF1 | 1-86 | MRCICGKEAKKGKISVKVYGIDIGQFEGYKCECGEEWFDEKTVDEIEKRSMELDIFGLGVKEKVSASGNSLIIRVPKKLAEFLNIK |
| A0A2H9LBM7 | 5-108 | INCHLCKGKAELKFEELLLDNGKIIIKDSPYYKRKKCKEEFSTSEQMHLLSGQINQNFVFQRPIINAGRSLAITIPVDIAQFYNLKK… |
| A0A2D6F289 | 71-169 | None |
| A0A7J4MZI9 | 4-110 | None |
| A0A7J4MTN3 | 23-125 | None |
| A0A7T9DJG9 | 1-93 | None |
| A0A2H9QUQ9 | 36-147 | None |
| A0A5E4KVM6 | 24-122 | None |
| A0A532TU06 | 7-117 | None |
| A0A2H9TF36 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.