DPCstruct | MC21605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 9.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A196NHA1 | 2-67 | PRPSPDSLERQSRVALLAWNLLGGDAAVRFLNSHDEALGGRPLDLAVASPVGCEAVEQAINARAER |
| A0A845AMQ1 | 1-83 | MTSERANPAPSHWRRRAKFVAIPQDQAVRQGNITRLAFIVLGKEAAIAFLNTECPDLGGRPLAVATASEAGETQVRAMLEKLV |
| A0A318BAY6 | 60-156 | None |
| A0A173L100 | 1-92 | None |
| A0A848SJ53 | 71-150 | None |
| A0A5B8LMJ5 | 17-96 | None |
| A0A7Y9N6M3 | 1-66 | None |
| A0A840Z2V9 | 4-78 | None |
| A0A0E9MT41 | 1-82 | None |
| A0A1I2NPG3 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.