DPCstruct | MC21604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Standard deviation of domain lengths | 13.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9AEG9 | 1-117 | MFSLMHPVNLFVFALLMTIPNAVGSSYEITVDVGKPSGNLKHFWRSTGFCPPLPHTQSNQYDLSRDQELNLAYVGSVPHRGIQQVRI… |
| A0A673IQF4 | 1-150 | MYSERECLYRCKHSSFTWTLFLSVLVIKQQQSVISSSVEVQVNVDKQLRNLKHFWRSTGFCPPQPHTDAHLYDLSPDQQMNLALIGS… |
| A0A6J0E376 | 79-208 | None |
| A7RUK1 | 1-127 | None |
| A0A090WR03 | 4-111 | None |
| S9XCN2 | 1-116 | None |
| A0A6P7FS97 | 1-121 | None |
| A0A2R9YJN2 | 1-129 | None |
| A0A067QN70 | 1-96 | None |
| A0A6I9YF32 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.