DPCstruct | MC21602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 243 ± 33 aa |
| Standard deviation of domain lengths | 32.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4FMM7 | 2-227 | YAPVKGPEHPDLTMQQRAPRNTLAGYVEKAHINAFEFENQRRTFHTYGYALDPSVDEQADGQSYVGDLQSAYDDNGKTVFEAPKAKK… |
| A0A673IJK0 | 1-265 | MAAAAAAFLVSYGSDSDSENESKSGTSPQKVDPDALAHLQPLKSGSVTSVAVLNSAPEVAVKEDVETGVHLDPALKEVTYNPTYETM… |
| B0WXZ9 | 1-246 | None |
| A0A5N5QTP4 | 1-296 | None |
| A0A448WGC9 | 57-312 | None |
| A0A212F6L7 | 1-220 | None |
| A0A1A9UZT5 | 32-273 | None |
| A0A540KD75 | 3-299 | None |
| A0A817D705 | 1-263 | None |
| A0A0C2ZP13 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.