DPCstruct | MC21600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 3 aa |
| Standard deviation of domain lengths | 3.15 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 93.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A694VAX4 | 1-110 | IIYVSYHSKEDPLTPANFKEQTMQILKILGYDVSLNLIDENKIDGKFIKNLDHGCGIPDKALFRKELPLMLEKLQKRKSFMRENSIS… |
| W4BBH8 | 283-393 | YIFHCQEDHIASVEDKDKLATLLMNYNSTYYKRVGKSDIDGELYKTYGHAMNASLRKLFDHVADQEREYGLVKETSKNEFLDNKTNL… |
| A0A698BXR6 | 97-207 | None |
| A0A828QYI9 | 58-169 | None |
| M1PJ97 | 278-392 | None |
| A0A3S4URA8 | 302-411 | None |
| A0A2S1GYD2 | 112-218 | None |
| A0A151B583 | 205-307 | None |
| A0A824Z6I7 | 41-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.