DPCstruct | MC21599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 351 ± 74 aa |
| Standard deviation of domain lengths | 74.37 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.62 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF13660- PF05161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6KWG5 | 20-391 | IINSGLQSINTEKIIRNNIKLKNNILNIKNKKINLKRYKRIFVIGFGKASSLMGKEIERILGSRINNGIIISTKNIQLKRINVIKGT… |
| A0A1B3WMU6 | 147-487 | VIDSILDQVRLAIAPDQLLYRIAQETETGYRFGDIDVDFSLYRTVNVLAIGKAARRMASALGNLIEERIDAGLIVSKTPFEMGEFPP… |
| A0A7W6C6G1 | 6-291 | None |
| A0A0G1ZNZ8 | 550-956 | None |
| A0A1F8RI35 | 1-395 | None |
| A0A0L7QNQ2 | 2-395 | None |
| A0A6L5D8K4 | 45-270 | None |
| A0A810Q683 | 18-413 | None |
| A6TL35 | 336-702 | None |
| A0A136KYL4 | 39-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.