DPCstruct | MC21598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19789 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B3WML5 | 1-85 | MSINKLEMYFVDDEDRQAFPTKYAIAKNVYVNDDLKTTWWWLRSSGSIGRYAAEIYPDGSIYYFGDYVYNGRVAVRPALRLRITP |
| A0A662ZJ36 | 177-271 | TEDRVFCLSTAEADSLFKDNESRKCVPTPYALGNGCWKSSENLINGRGCCYWWLRSPGRYRLLVAGVSTDGSLLLDGGGVCGGNIAV… |
| A0A3D2GXL5 | 936-1024 | None |
| A0A3D2G0M4 | 409-505 | None |
| A0A1G4QHL2 | 586-658 | None |
| A0A374TYK7 | 245-333 | None |
| A0A1G9IX51 | 771-860 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.