DPCstruct | MC21595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 241 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A766S6M6 | 1-247 | GPMQLEVPRDQYAGAVETMKNKIREGKVPGVTDPAEASRLIRRGHLTYTQARNITRFGTIESVTYDIAEGSVVSLAAGGISFALTAS… |
| A0A3E4SM71 | 82-345 | CSSPSKTIGAAFSDGSYRYGGMKLEVPKEQYDECVRLMADKIRSGQVPGITDPAVAKDIVIKGNCTYNQAVNIAKAGTLDSVKFDVK… |
| A0A5C5BX58 | 36-302 | None |
| A0A6B4QWQ3 | 1-264 | None |
| A0A8B3DN79 | 455-684 | None |
| A0A062XC88 | 27-250 | None |
| A0A6D0SCP1 | 1-226 | None |
| A0A231PVK5 | 363-616 | None |
| A0A2T0W3U9 | 95-296 | None |
| E6UD62 | 122-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.