DPCstruct | MC21594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 46.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3JIV3 | 45-104 | PANCILITTLSNLAIYLKQNTARLFFKQEVREDSLNVYFSIQLDYLLENHRHAVLIEGIE |
| A0A765TBE3 | 1-64 | PDSTMLITSFNNLSIYWQKGSMRRLMKDEPEYNRIATYQSINDAYVVEDYGKCAMVTGLKFADS |
| A0A479K4D9 | 1-59 | None |
| A0A6N8PMR1 | 51-119 | None |
| A0A7Y8F676 | 35-98 | None |
| A0A2X3DS40 | 7-70 | None |
| A0A5E7HSG9 | 103-159 | None |
| A0A2X2ZU79 | 1-54 | None |
| A0A381GKK8 | 68-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.