DPCstruct | MC21592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S4VL97 | 1-126 | MRPFPQHSSNDKALSELWDEYRQRMIGLSGIAIFLFGNKLHDGRIVNADGVRREFQIAQETGVVVLPLGVTGYMAKELADEMLTDPS… |
| A0A3D6AKI2 | 1-104 | MLDFAGISIFMFGNKVDPTSSGILQSGGMFEEFDIACAKGIKILPLGFTEHVARQLYDKVKASLSTYYPRATPAFSQLFDELGDGSR… |
| R4XEX9 | 74-216 | None |
| A0A164JIR1 | 38-140 | None |
| A0A7Z1UPC3 | 31-163 | None |
| A0A1H7UAR7 | 65-194 | None |
| I0R6Y1 | 45-157 | None |
| A0A078MVM1 | 124-239 | None |
| A0A1Y2F9U2 | 1-116 | None |
| A0A7X9IJN6 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.