DPCstruct | MC21589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 223 ± 26 aa |
| Standard deviation of domain lengths | 25.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A7ZF40 | 17-229 | LERTIESENQKFEEFLKENERKSVEARTLSEREEKSKREKNLQMKKLAAEIGSIKSEIANFEEILIDYKRYQEFLFKISPPEWQEEQ… |
| A0A5N5LVB7 | 30-260 | YFTDPKQLLNIMAEMEEETNHLFQDLDFIEQSLEFYKESEGKQHMYMEKEAAWVSKEIDYLTNCINENKAKAAEIQEKVKLFNMSED… |
| A0A1I8GUT5 | 13-224 | None |
| H2YIP6 | 198-420 | None |
| A0A2Y9FX57 | 600-819 | None |
| A0A672V281 | 164-396 | None |
| A0A672V5W7 | 313-494 | None |
| A0A670IW03 | 208-481 | None |
| A0A7J6KZW0 | 285-573 | None |
| A0A674CXN0 | 215-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.