DPCstruct | MC21587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 23.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8RAB9 | 18-107 | GSASWCVSVQDEDEEDDLLPPEQKAERERERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQV… |
| A0A5N5KZ61 | 35-148 | APPSISSNHRIPTSSYQYSVSEECLTVEEKEQRDRERRLANNARERVRVRDINEAFRELGRMCQLHLKSDKAQTKLIILQQAVQVIL… |
| Q60722 | 527-664 | None |
| A0A4W6E6A7 | 1-116 | None |
| P15806 | 508-645 | None |
| A0A667I5C4 | 590-705 | None |
| A0A0K0E305 | 13-154 | None |
| A0A212C6K5 | 29-169 | None |
| A0A498NP44 | 1-102 | None |
| A0A4Y2V1U9 | 58-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.