DPCstruct | MC21582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 150 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9ILN7 | 3-129 | AYIMGERETMPTVKKLLPHSMSTIYYLLADFYFKNGKWSAAIRYYLLDLCFHPTRLSSWTGLAMSSATVIDTWLNKYTPINEDKLLA… |
| A0A182SQ67 | 417-570 | SRPISEFIDGKGNTLPEAANILQSEVKPIFYLLADFYFKSRDFTRAIRYYVMDLALEPSRFDSWAGISLSKASKVETKLNSTETIPL… |
| A0A6J8CF10 | 389-540 | None |
| A0A5B7EEX9 | 14-170 | None |
| A0A3Q0J9L4 | 172-330 | None |
| A0A132A365 | 230-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.