DPCstruct | MC21581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 200 ± 38 aa |
| Standard deviation of domain lengths | 37.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0TMJ3 | 1-228 | MLNLLINRKQLNYLHLDYNFNLKPTKTLTTKERKKSRFGNAFHLTREILRLTKLVVDAHVQFRLGNIDAYQLADGLQYTFNHVGQLT… |
| A0A2I0HJX3 | 1-174 | MLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREILRLTKLVVDANVQFRLGNVDAFQLADGLQYTFSHVGQLT… |
| A0A4S8M920 | 213-443 | None |
| S9UW48 | 540-780 | None |
| A0A7J7IFK1 | 166-305 | None |
| A0A2S4VAW8 | 313-575 | None |
| A0A072VVA3 | 75-241 | None |
| A0A0C2ZSK1 | 244-430 | None |
| A0A0C9YRZ3 | 152-342 | None |
| A0A1D6NUH7 | 530-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.