DPCstruct | MC21580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 221 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0272- PF02194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1P9P3 | 153-362 | DLQQATLERLGPNMHVAMLSRKCELEYLRRLVESLFPYILPPQAVKSKCTCALIREILAGSVLLPALDAVANPDMVNNLILIFLDKT… |
| V9IKE0 | 1-216 | MSSFGNQLIDHFGCEIHPASYSRKAELNYLRGIVTAIIPHLLPAIHVSINNKVILREILANWILLPAIDAIADPDNINALITLATHH… |
| A0A0M3IPP1 | 2-244 | None |
| A0A817PNF8 | 514-736 | None |
| A0A444TFD9 | 209-419 | None |
| A0A0R3QD05 | 1-240 | None |
| A0A1B6FL48 | 187-417 | None |
| H2ZAZ3 | 2-191 | None |
| A0A7R8VR36 | 183-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.