DPCstruct | MC2158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 171 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9ZCN3 | 257-454 | MTVPTPMPIPTPTSIPTLMPSMVRETLKEVFRGDMMTKLQPLLDRLKSENWNGIIQRDIMGVLTEKNVRVLPSLAKNTLYLWADRSQ… |
| A0A428RS42 | 8-174 | SASEVKSEPERPPPALRPEPKVGNQRKFLITRKDAMKRAGGVETRICDMSFDQVALIPSMRRWLNRPVIKVLSERMKKKLFDWCQQY… |
| A0A2T4AVJ0 | 1-163 | None |
| A0A2H3TRM6 | 1-182 | None |
| A0A2T4BNJ0 | 5-158 | None |
| A0A2T3Z0S0 | 273-436 | None |
| A0A2N1LGZ6 | 24-159 | None |
| A0A6M7YQJ1 | 1-139 | None |
| A0A6V8QZW2 | 1-151 | None |
| A0A2P4ZBP3 | 241-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.