DPCstruct | MC21579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 55 ± 2 aa |
| Standard deviation of domain lengths | 1.73 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 83.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8N013 | 44-97 | MQNRLVRLVCVFLQSLIRNRIIDVKDLFIEVQAFCIEFSRIREAAGLFRLLKTL |
| A0A540K3K0 | 1-54 | MQNRLVRLVCVFLQSLIRNNIINVKDLFIEVQAFCIEFSRIREAAALFRLLKSL |
| A0A132A7Y2 | 308-360 | None |
| A0A7S3LRX9 | 153-206 | None |
| Q4T745 | 32-85 | None |
| A0A0Q9WFN2 | 59-116 | None |
| A0A7S0LXJ1 | 78-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.