DPCstruct | MC21577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Standard deviation of domain lengths | 15.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9IIG3 | 10-108 | NRLKDVIRSYFDGEVLLDIDFNKQNIIENEAQIACDVRNLIVSYRDNNFTGRAVARIFHGIQSPNYPAYVWNKCRFWRIHLSCNFNV… |
| A0A402G4W6 | 5-73 | EEQIRADIRHFLSIRQDEKFSGRAVARVLHGIGSPRYPAQVYGRDRRFWRKYIHFDFNKIMRLATEEII |
| A0A7J7MNJ8 | 144-263 | None |
| A0A453C9M1 | 86-209 | None |
| U4UAZ0 | 1157-1260 | None |
| M7BWK7 | 54-161 | None |
| A0A067K3E5 | 258-359 | None |
| A0A183WGB8 | 9-97 | None |
| A0A813NG33 | 145-227 | None |
| A0A0D2ML36 | 164-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.