DPCstruct | MC21574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Standard deviation of domain lengths | 13.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444ULZ8 | 349-480 | YLSLSLAVLLVDATLSKTDAKKAAAKNQEKETQLSDRLAQDRGLVITDPKAKDIVKEHGRYCGDKVRERQLSGAVLGYITPWNSHGY… |
| V9IGQ2 | 1-133 | MNIFSLMISLLLFFQLSECTLSPPKDRNNKKNKGKIEFKKGPVEQDVFSRILVIKNPKTHDIIRESGFYFFNTTRRRFTGEVLGYIT… |
| A0A6I9WKI7 | 5-115 | None |
| A0A0L7KUL7 | 9-139 | None |
| D8M2C8 | 445-559 | None |
| A0A118JU77 | 20-164 | None |
| A0A7J7HJY0 | 268-373 | None |
| W5P3T2 | 1-132 | None |
| A0A452FW39 | 5-128 | None |
| A0A1S0UJT5 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.