DPCstruct | MC21573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 239 ± 42 aa |
| Standard deviation of domain lengths | 42.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9IG34 | 5-231 | WFYLPIVHIYTKYRNNNICNDNDKTVVLTVLSLELILPDLVEKLSQTLRFSRLILIYLCDTLYLNNDVSILLTKVVTTLVKDNYKKF… |
| A0A6I9NRG7 | 3-204 | VIPPVAKLARLSCVFLCSSDLFLERPVQKLTWGLFRLLTRRSRLDSLDLDVPPPGLASFQDLYTALLTQYEAVSFGDRLFGSWLLLP… |
| K7K7W3 | 1257-1549 | None |
| A0A6J1QBU4 | 479-705 | None |
| A0A2H1C6V0 | 405-682 | None |
| A0A1A9WBV2 | 703-920 | None |
| A0A182SE95 | 272-481 | None |
| A0A2C9V181 | 644-884 | None |
| A0A158QCB7 | 807-1017 | None |
| A0A5B7E2T6 | 443-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.