DPCstruct | MC21572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 198 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9IG03 | 1-195 | MTTIRKSHILKLDVSGKFAINVVDNLIIVHHQTTKTSMIFDIMLPGISDGTVMHHTSVAPAKPIKPYSLKVPGTTLSNETYQSCQLY… |
| A0A7S4EV17 | 37-209 | QTLSLYQLFKDFVVRKHTLQVYSSQVSVSVSDNLLLVHALDSRVVLLFDIKINTQFPVTAPLPLSTAPSDGFSASYAAHWVFAAPDL… |
| A0A024V3Z2 | 303-470 | None |
| A0A0A9CX90 | 68-264 | None |
| A0A5K3FFF3 | 3-219 | None |
| T1EWG2 | 100-280 | None |
| A0A1I7RWY7 | 1-208 | None |
| A0A1U8GG99 | 1-197 | None |
| W9RD57 | 1-201 | None |
| A0A151ZJ11 | 206-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.