DPCstruct | MC21565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7S0S4 | 46-137 | AVAEPQIAMFCGKLNMHVNIQTGEWEPDPSGTKSCFGTKEEVLQYCQEMYPELQITNVMEANQPASVDNWCRRDKKQCKSHIVIPFK… |
| V9ID23 | 34-124 | SEPQVATLCEAGEVYLAQHMGEQGRWVSSTDKKSCMTDKLEILEYCKKAYPKRDITNIVESSHYVRVSGWCKPGRTKCKLSRWVKPY… |
| A0A3D5YNB7 | 168-259 | None |
| T1EIP9 | 2-85 | None |
| A0A6I8PAV6 | 73-166 | None |
| H9GNC2 | 18-114 | None |
| A0A183M4U8 | 9-101 | None |
| A0A504Z688 | 1-122 | None |
| A0A0S7JU34 | 16-127 | None |
| E4XRI7 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.