DPCstruct | MC21562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 273 ± 43 aa |
| Standard deviation of domain lengths | 43.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6CP93 | 5-236 | KNFNLPCALNFLNYLEETQALLKISEIENSISFSIQRSNSISLLGLTYCKINQINNYYTHFFKKYTQCLWAKKLSDFGISYKEAFKN… |
| V9IBJ8 | 72-335 | TLFKKVINSRMFDLQLSLSCLFMLSDSEACKWISSICKSFQSDYTRHLRITVLGYEYFYLTKNQTLQTFKNNKILYYWAQKLSKYLV… |
| V5GQ61 | 2-227 | None |
| A0A1A8M8V5 | 37-306 | None |
| A0A7R9B1M3 | 67-305 | None |
| S4R4E1 | 94-462 | None |
| A0A1X7TE75 | 4-255 | None |
| V9I995 | 17-303 | None |
| A0A0W8DCK1 | 643-891 | None |
| A0A1A9YBU4 | 96-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.