DPCstruct | MC21560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 384 ± 91 aa |
| Standard deviation of domain lengths | 91.40 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673M441 | 14-359 | LSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKSKKTFLGQNKSFWGPLELVEKLTPEAGEITASVKDLPGLKTPLGRGR… |
| V9I7V3 | 1-372 | MLDSDHMPLQHFFIVLEHVLRHGLRPKKGLLGPKKELWDILQLVEKYCPEAQDITSSIRDLPTVRTAMGRARAWLRMALMQKKLADY… |
| A0A6J3GB39 | 23-405 | None |
| A0A5J4NF25 | 23-422 | None |
| A0A4U5UIF9 | 8-534 | None |
| G3HRX9 | 1-227 | None |
| A0A6L5CSF5 | 319-807 | None |
| A0A2P6NIZ7 | 27-407 | None |
| R7UKG3 | 29-367 | None |
| A9UYK5 | 6-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.