DPCstruct | MC2156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 245 |
|---|---|
| Mean domain length (aa) | 195 ± 35 aa |
| Standard deviation of domain lengths | 34.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 99.40 |
| Assigned Pfam label(s) | PF04205- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A063BQE1 | 259-492 | VLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLAS… |
| A0A428RKN2 | 31-200 | GIVVANQGERVGAEDVYGALLIEKMMRKHQSQGFAIYDSTQWAKAKKQLPTQGLRQTVDAYNDAIKNDKPDPANKMSDTRSPILKPP… |
| A0A522PCZ1 | 518-725 | None |
| A0A7Y3N558 | 51-266 | None |
| A0A7J2IQA9 | 66-288 | None |
| A0A2K2U430 | 196-408 | None |
| A0A849EW19 | 36-228 | None |
| A0A842YI23 | 13-244 | None |
| A0A7S1KQY3 | 635-841 | None |
| A0A369LAG4 | 12-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.