DPCstruct | MC21554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 132 ± 24 aa |
| Standard deviation of domain lengths | 23.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.06 |
| Pfam Score | 97.78 |
| Assigned Pfam label(s) | PF00010- PF01056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7RG56 | 2-77 | DKRAHHNALERKRRDHIKDSFSHLRDSIPSLQGEKASRAQILNKATDYIQFMRRKNHSHQTDIDDLKRQNLILDQQ |
| A0A1I7TRQ8 | 98-235 | LSDSGSDDDTISPKSASPGIDDDRRAHHNELERRRRDHIKDHFVILKDAIPILEGEKSSRALILKRAVEYIIVMQNRLEEYKKNLEE… |
| L5KEY0 | 70-200 | None |
| A0A177B7T1 | 1-151 | None |
| A0A7R9KC88 | 31-179 | None |
| A0A1X2I543 | 324-470 | None |
| R7T5M6 | 11-149 | None |
| A0A6P4L807 | 51-179 | None |
| A0A3Q0KH90 | 41-172 | None |
| A0A194PFZ8 | 19-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.