DPCstruct | MC21553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03409 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3DWU5 | 292-433 | NGLVQFSQSALYDIYDFQGVKEVPLANCANGCYIFASTTETAQDAYMKNLVVHDYASGKDMSIAAISKQIQVGTSQKLPYDLVAAGR… |
| G0NSG1 | 1-132 | MKVLFIFFSLLFSIATCQQLINLSSFKGGNVKNQLNGGKKYGIFVSALADSSDLLQNISVVQEDGEVVTLEKLKNLKASNESGELKP… |
| A0A2A6B5D6 | 12-145 | None |
| H3E631 | 1-156 | None |
| A0A2A6CJ64 | 325-481 | None |
| A0A2P4WF64 | 194-306 | None |
| G0M8X4 | 1-131 | None |
| U4PE42 | 1-164 | None |
| H3EVI6 | 11-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.